PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_20277.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 172aa    MW: 18786.9 Da    PI: 10.4986
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_20277.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-152064347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
     MLOC_20277.1 20 PWTEDEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 64
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.9291369IPR017930Myb domain
SuperFamilySSF466898.61E-181469IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-171667IPR006447Myb domain, plants
SMARTSM007171.4E-121767IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-121763IPR009057Homeodomain-like
CDDcd001674.81E-122065No hitNo description
PfamPF002491.3E-122064IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
GGGRRHGGRT PEQERKKGVP WTEDEHKLFL LGLKKYGKGD WRNISRNFVQ TRTPTQVASH  60
AQKYFIRLSS GGGKDKRRSS IHDITTVHLT DDQPPSPSQS SMITQSSAPA PSSATGQFSL  120
PPDTKQHGGA NAPYNSPSRT MGMPSYGMGL QDQGLQCGPL HDQLAANRSM LY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3621840.0AK362184.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003C15.
GenBankAK3631920.0AK363192.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013G01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.11e-103PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-53DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM0V8H21e-126M0V8H2_HORVD; Uncharacterized protein
STRINGMLOC_20277.11e-125(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.18e-28Homeodomain-like transcriptional regulator